SGD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
New Products
Product Details
Description
Age Range: 4 - 5 years
Grade Level: Preschool - Kindergarten
Paperback: 16 pages
Publisher: HarperCollins UK (January 1, 2005)
Language: English
Product Dimensions: 7.8 x 0.1 x 8.3 inches

Hippo wants to play on the see-saw. But who will play with him? In this humorous story a hippo wants to go on a see-saw, but no other animal is heavy enough to get hippo off the ground. It takes a group of animals to do it – and in the end, it is a tiny mouse that makes the difference.

• Pink B/ Band 1B books offer emergent readers simple, predictable text with familiar objects and actions.

• Text type - A story with a predictable structure and patterned language.

• Pages 14 and 15 feature a flow chart, an ideal opportunity to retell the story in sequence.

Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------