SGD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
0 items
New Products
Product Details
Learning to Sequence: 3-Scene Sets Game
Learning to Sequence: 3-Scene Sets Game
Brand:Carson Dellosa
Product Code:CD-140088
Product Condition:New
$24.05 inc. tax
$22.06 ex. tax
? Tax based on Singapore.
Add to Cart
Description

Learning to Sequence: 3-Scene Sets Game

Children will eagerly assemble the pieces of Learning to Sequence: 3-Scene to determine what happens next in 16 picture stories.

For added fun, have children narrate the story from each scene. Each set includes 48 photographic cards plus game directions in English, Spanish, and French. It is perfect for ages 4 and up.

Features:

  • Resource Guide
Product Added to your Cart
x

-------- OR --------