SGD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
0 items
New Products
Product Details
Description
Age Range: 4 - 5 years
Grade Level: Preschool - Kindergarten
Paperback: 16 pages
Publisher: HarperCollins UK (January 1, 2006)
Language: English
Product Dimensions: 7.8 x 0.1 x 8.3 inches

A picture story about three hungry ants. The ants want to know what is for breakfast but they are not keen on dads sweet offerings. Finally he suggests an apple; an offer that everyone is happy with. The book includes several discussion features, such as speech bubbles and a clock that shows the passing of time.

• Red B/Band 2B books offer simple but varied text with familiar objects and actions, combined with simple story development and a satisfying conclusion.

• Text types - A story with a predictable structure and patterned language.

• A story trail on pages 14 and 15 summarises the different stages of the book in sequence.

• This book has been levelled for Reading Recovery.

Product Added to your Cart
x

-------- OR --------