SGD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
0 items
New Products
Product Details
Description
Age Range: 6 - 7 years
Grade Level: 1 - 2
Paperback: 24 pages
Publisher: HarperCollins UK (January 1, 2005)
Language: English
Product Dimensions: 6.7 x 0.1 x 8.3 inches

Collins Big Cat is a guided reading series for ages 4–11 edited by Cliff Moon. Topchildrens authors and illustrators have created fiction and non-fiction books that your children will love to read, banded to help you choose the right book for every child. Practical ideas for guided reading are included at the back of each book.

• Orange/ Band 6 books offer varied text and characters, with action sustained over several pages.

• Text type - An information text.

• A wordless flow-chart on pages 22 and 23 summarises the process and helps children remember the sequence of events.

• Curriculum links - Design and Technology: Investigating and using materials, different joining techniques; Science: Structures; RE: Celebrations.

• This book is paired with a story on a similar theme: Arthurs Fantastic Party by Joseph Theobald.

Product Added to your Cart
x

-------- OR --------